DPCstruct | MC4506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 129 ± 23 aa |
| Standard deviation of domain lengths | 23.47 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A365VNG4 | 1-162 | VAEIHQLGQLVNGRLGQTEKAATELTAAAEQVQELVSKFIIGDGAFDQAVNRARDVRDQVQQLLQDAQQGGLDLFDQRYQQVAGTAP… |
| A0A533J9U5 | 132-233 | SIDAADRILIEAVQKAAKETSAAFETAILSGRITERELFEFKYRPIPGTDPQQYEAPFSAMCDSLLPSIQEPFLEIDPRVVFCAAVD… |
| A0A3D1ZTE5 | 171-337 | None |
| A0A0Q6K4S5 | 350-456 | None |
| A0A7C4N3Z8 | 6-124 | None |
| A0A364NZN4 | 261-411 | None |
| H0SUQ1 | 746-855 | None |
| A0A0D8HEG3 | 416-530 | None |
| A0A1C3V985 | 2-145 | None |
| A0A512H3B1 | 551-659 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.