DPCstruct | MC45050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 101 ± 9 aa |
| Standard deviation of domain lengths | 8.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 30.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H0A001 | 1-109 | MKQLNSNGSARSELVKKYGYDTKFYMHTVRLLEMAIEILTYGLLTVKRKDYARLLSLREGIHTLDDALDHIESLEQRLKIAYEESTL… |
| A0A2W7ASM3 | 73-168 | EEKVGYDSKHSGHCYRLLKSGIEILNGDGVIPNREITGDAQFIRQIRNGEVPYDHLIEAVSNLEIELESAMKNTKLPKYPNQKLIEE… |
| A0A1Z4TQ28 | 2-87 | None |
| A0A8A3TAC5 | 42-145 | None |
| A0A349YR52 | 103-203 | None |
| A0A1Q8B5R3 | 57-148 | None |
| A0A238XF22 | 107-209 | None |
| A0A024FFQ6 | 64-169 | None |
| A0A2K8T0T6 | 129-227 | None |
| A0A533QG14 | 6-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.