DPCstruct | MC4505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 77 ± 4 aa |
| Standard deviation of domain lengths | 3.88 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q8CYT5 | 1-85 | MNCRGHETRQRIVRDFEVQPKVHIKLLANQQKHSDAGATIEDEYYVFIAESKIDGKKEVIQCCMGAARDFLELINHKGLPLFNPL |
| A0A348DK76 | 3-83 | WPKEYSKTTQAVRDAAFKLYYVEAITQSVLLPGQVKTAYHGGPLTTGYYLFLFTSRENPKLTGYFTCGLYAAKGWFEVNGQ |
| A0A174H491 | 16-94 | None |
| A0A1C6GDB1 | 1-79 | None |
| A0A5P2EZT5 | 7-82 | None |
| A0A1T1DCJ1 | 1-77 | None |
| A0A2A2M7Z0 | 11-88 | None |
| A0A2M9Q9Y2 | 5-76 | None |
| A0A546X903 | 6-77 | None |
| A0A7X4ZRE7 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.