DPCstruct | MC45045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 159 ± 17 aa |
| Standard deviation of domain lengths | 16.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 46.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C1MQL2 | 48-220 | NPPADGAGIVSCAHCYKRYKTVELLREHERDAGHSRHDPRCGECGKHFACVDTLRQHLGLTTGPSAARCKSAFEARGGCARCVFIPP… |
| A0A6P5F6Z1 | 1-178 | MDGSSENLRNKCAACFRQYNKMEHLVEHMRVSFHSSHEPKCGVCQKHCRSFESLREHLIGPLPKVDCARIFGIRGCNLCLNIFDSSS… |
| A0A1R3I5K3 | 279-444 | None |
| A0A1E5VJF8 | 1-159 | None |
| A0A0A0KRX5 | 1-150 | None |
| A0A1R3IDK3 | 1-175 | None |
| A0A218WFF6 | 1-150 | None |
| A0A067FZD2 | 9-184 | None |
| A0A2G2VA68 | 9-132 | None |
| M1BML2 | 1-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.