DPCstruct | MC45037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 82 ± 15 aa |
| Standard deviation of domain lengths | 15.04 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 50.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W1BI89 | 19-102 | HSRRKREAPYVIYPEILVIVDYDGYRLHGGDNVQIKRYFVSFWNGVDLRYKLLKGPRIRISIAGIIISRVSFMLDKIILYYFGI |
| A0A7M7J0G0 | 202-266 | DVPLDTLYPKLLVVVDYHLFKLLGKDVTRTVRYVATFWNIVDQKYERLETPKVQVIVTGIVIVED |
| A0A482XTE2 | 200-277 | None |
| A0A139WEN2 | 243-326 | None |
| E9FRL1 | 134-203 | None |
| A0A834XJX6 | 471-547 | None |
| A0A6H5GHZ2 | 171-248 | None |
| W5JM39 | 91-179 | None |
| A0A232FHS3 | 198-283 | None |
| T1IYR4 | 137-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.