DPCstruct | MC45033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 59 ± 5 aa |
| Standard deviation of domain lengths | 4.67 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 42.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843LZT1 | 1-67 | MELHRIFLNYFIFGRDSLLSVQDLWRYCVPFDEFRQQYGTIIMNGGTGEYSDNRMLLPYHGYWVYMT |
| A0A7K3YA60 | 159-213 | SSANETLASVEDGWVYVLGYDAQNQEYQPALINDQIGPRGENQNLFPTEGYWLFM |
| A0A1V4UD37 | 438-495 | None |
| A0A1V4URJ0 | 1-55 | None |
| J1L3U7 | 726-779 | None |
| A0A1V6KA60 | 187-246 | None |
| A0A7L4Q0B8 | 41-106 | None |
| A0A1V4UFK5 | 1102-1159 | None |
| A0A7X8JKF7 | 212-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.