DPCstruct | MC45030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 154 ± 29 aa |
| Standard deviation of domain lengths | 28.73 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.19 |
| Pfam Score | 89.07 |
| Assigned Pfam label(s) | CL0722- CL0697 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V6Q5Z9 | 203-335 | PFRTASKMLEIARENHMQLWEIATFYEAGRSGWSKEEVFSKMKQIATIMTSSVQTGLDGKMKMEGILRPQSMLIGKAEEKGTLIPVG… |
| W1VUQ7 | 10-153 | EQAELDFQGNVAELMIRTEYELTGREREEVLLLMERNLEVMKASDELGLSEKKSRSGLTGGDAAKLDHYIKKGKTLSDFTVLSAARN… |
| A0A564UIC6 | 171-328 | None |
| A0A4T0KII6 | 442-657 | None |
| A0A7H4MRF0 | 42-160 | None |
| A0A365VL53 | 14-143 | None |
| A0A7J2L367 | 22-206 | None |
| A0A439EZ45 | 45-156 | None |
| A0A4U9W355 | 83-190 | None |
| A0A3P8LYT2 | 10-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.