DPCstruct | MC4503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 133 ± 25 aa |
| Standard deviation of domain lengths | 25.31 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 68.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.90 |
| Pfam Score | 98.81 |
| Assigned Pfam label(s) | CL0220- PF02187 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820RF93 | 1-90 | ADIDRIKSEVHRQTSLCQCSNKYDVQQIAEGRYRFGGSQSLRLVRILRSTVMVRVGGGWTALDEFLVRHDPCRGNRKKRAIYRTTAF… |
| A0A2G8KVN5 | 24-134 | KNPRPPSGKSKKTIGKLDKEVQCIAKVCKVDVHRVSEGRYNILGKLVFVRMLRGRHVMVRVGGGWDTLEHYLIRHEPTSFRLHSRNM… |
| A0A7S1MDH3 | 481-621 | None |
| A0A3P6HVG3 | 92-216 | None |
| A0A6J0J3Y9 | 155-311 | None |
| A0A7J6D2R4 | 423-562 | None |
| A0A834XUQ4 | 227-349 | None |
| B4DWX4 | 7-124 | None |
| T1EF51 | 38-199 | None |
| A0A1I8IRY1 | 26-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.