DPCstruct | MC45027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 443 ± 70 aa |
| Standard deviation of domain lengths | 69.87 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 93.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4LXF7 | 232-738 | FVANYSKGLRHDSLGDVDPASYQSLLHALNTRNPADFEAIILGPGGKKLTNPQAGLAFTLEGPDTHAVTMPPAPRIDSPQGSGEMGE… |
| K7ZUA3 | 89-592 | LFDGQFHKSLPHDDVGRVNPEAYQLLLDCIESNDINVCDQVPSGVESDGRKLVNPLGGGGHQVDGADSDNIFIKQPDNLLSERLAAQ… |
| A0A2V9ZXU7 | 65-527 | None |
| A0A4Q7EYM1 | 11-480 | None |
| A0A838DZL0 | 1-400 | None |
| A0A6C0D019 | 70-552 | None |
| A0A2V8TU05 | 2-327 | None |
| V4XXI6 | 1-397 | None |
| A0A7Y4KPB1 | 49-557 | None |
| A0A1H8XPB9 | 28-603 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.