DPCstruct | MC45024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 188 ± 35 aa |
| Standard deviation of domain lengths | 35.28 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 15.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523A0W5 | 1-176 | MKVESGMVRIVRITAVPRLDPIRVTLDDLDPGKGRINIECWGRAWASYWGAMGNNTLAQFFCKCDNDYLIQNLASGKNLEPTRFSAE… |
| A0A090S8D1 | 8-203 | EDQIKAELLRAVANHSMQIINDDKEHRFLRFSNNGSSNYHFDIVTYPGHLVISGDIGTYVFARLNDMFEFFRSDEMKINVGYYSEKL… |
| A0A7R7DA97 | 1-144 | None |
| A0A838Z8C1 | 7-170 | None |
| A0A5R8QH14 | 3-194 | None |
| A0A4Q8RZB0 | 33-207 | None |
| A0A415ZJX4 | 1-249 | None |
| A0A2S7IQ46 | 1-130 | None |
| A0A433X9W3 | 7-227 | None |
| A0A5E7N0M1 | 1-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.