DPCstruct | MC45022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 131 ± 21 aa |
| Standard deviation of domain lengths | 20.54 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522SK65 | 451-591 | PASSLYVLNADNPNAPLVETDPAFTQRGQWLSLDYMLNGLGLDPATLQRRLGDGFYEQQLIQQQVGQLTAQRFIGDYTSNDAEYRAL… |
| A0A4S4B1W5 | 16-154 | LFQANPDPQAGHFIETDPRFANEAQWLSSAYMLDALGLDPAMTQKRLGDGFYEQRLVREQVAQLTGRRFLDGHADDEAQYQALMNAG… |
| A0A7U9JJU0 | 52-210 | None |
| A0A5E6NVC0 | 45-189 | None |
| A0A6M3ZNL5 | 3-94 | None |
| F7L434 | 236-382 | None |
| A0A1M5YSW4 | 134-285 | None |
| A0A6N8K9K3 | 13-127 | None |
| A0A3S4HSK5 | 22-164 | None |
| A0A561L5Z1 | 590-726 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.