DPCstruct | MC45021
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 351 ± 29 aa |
| Standard deviation of domain lengths | 29.21 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 66.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7L434 | 1-387 | MARSHLDHNDRRMMTSSAQYPEVALKGKIRSKADTRYGKVLAGRNITIEGKNGGNSQEVLNKDAIISAGNTVKINANKIENSVSIGN… |
| A0A366I7N9 | 1-317 | MLSGHTTRYNWSDIWFTRNKYGVNTAHMPDGYADERFYRYRYTRTVSETRVKESEPGQILSGGNLWLTAARMTNSDSRVIAAGLLMD… |
| A0A7Z7KNU1 | 4-388 | None |
| A0A6I6SJA9 | 2-388 | None |
| A0A6M5Z857 | 1-313 | None |
| A0A5C2EP47 | 2-333 | None |
| A0A661KQU2 | 1-342 | None |
| A0A510KH65 | 55-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.