DPCstruct | MC4502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 286 ± 32 aa |
| Standard deviation of domain lengths | 31.54 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M0JWI3 | 60-322 | SSPDAVVYDSPHPYPPDAVLTEPVSLPGASRVYVAFHEQTRTERTASVTLRWRSAHDGFQHTSERFAGAAAQWPGAGKMPVLEIPAD… |
| A0A2G8KV22 | 146-427 | LDLMRMLVDSEGCTLYWIPHYLTKRRYGHSRGARYLLIKFDERCCTEDCCDILTIASDNKYKHNVRTFSGSSGNWINFDIPGDTLYY… |
| A0A6I9MQE0 | 64-387 | None |
| A0A2I0TEM4 | 673-984 | None |
| A0A1S3IJR0 | 355-583 | None |
| K1P9P5 | 713-1003 | None |
| A0A7S4J2S1 | 330-571 | None |
| A0A3S1BL12 | 560-874 | None |
| A0A6A3TBY2 | 990-1239 | None |
| A0A0R3QPP7 | 4-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.