DPCstruct | MC45016
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 199 ± 27 aa |
| Standard deviation of domain lengths | 27.13 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 36.58 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0023- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060W4U0 | 276-487 | KPLLLEHLPHLFTCLQHPYTAVRHMAARCVGVLSKIATMETMHLFLERVLPWLGCIEDSTKQEGAIEAMACVMEQLDVDIVPYIVLL… |
| A0A1B6Q9F1 | 1-175 | MAKSLTDDVMVLVIENVIPMLSDLSSVCARQGAGILLSLLVQGLAVELVPYAPFLVVPLLKCMSDPDGSVRQTVTHSFAALVPLLPL… |
| A0A453A4V6 | 178-389 | None |
| W1PDA0 | 2-170 | None |
| A0A511K957 | 1054-1253 | None |
| A0A158Q4S1 | 911-1167 | None |
| T0LCC3 | 3-176 | None |
| A0A2G3D295 | 109-324 | None |
| A0A3P7DZJ0 | 26-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.