DPCstruct | MC45015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 3.81 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 50.51 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF04446- PF14413 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6Q2A2 | 9-76 | DIDISTNNFSKILSLCVSYFTSVYVMKWKDFFPIKELKEPPYFDARAVCYPNLKTIRDYLAWRQVDCH |
| A0A0B2RME5 | 115-184 | KKATNLYQRRANTIISAIVSFFTSTYVMRWKNFFPQSELKNPSSFDGRAVCNPSTEILRDYLSWRQVDCH |
| A0A1B0AUF8 | 28-101 | None |
| A0A453EKD1 | 37-105 | None |
| A0A453JST2 | 30-99 | None |
| A0A4P9YV14 | 20-90 | None |
| A0A287QGK5 | 3-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.