DPCstruct | MC4501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 146 |
|---|---|
| Mean domain length (aa) | 193 ± 47 aa |
| Standard deviation of domain lengths | 47.43 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 81.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.53 |
| Pfam Score | 98.08 |
| Assigned Pfam label(s) | CL0137- CL0124- PF00110- CL0065- CL0158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A674HSY6 | 589-796 | LPRDWLWGGCGDNVEYGYRFAKEFVDAKEREKNYVRGSEEQARMLMNLQNNEAGRRAVYKLADVACKCHGVSGSCSLKTCWLQLADF… |
| A0A2G8KSN9 | 64-258 | DTVEVDSDANSLMNLHNNEAGRKAVRSTLEKRCKCHGVSGSCTLQTCWTQLSDFSTIGRFLRKKYLTASQVDLSRGHLTQSNDFMEV… |
| A0A3P7CV01 | 1-211 | None |
| A0A2T7PZY9 | 195-422 | None |
| A0A1Y3BGE3 | 1-164 | None |
| A0A556TK44 | 790-996 | None |
| A0A218VE97 | 266-379 | None |
| A0A6P4L3Y6 | 246-412 | None |
| A0A139WF66 | 371-574 | None |
| A0A182F0Y5 | 82-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.