DPCstruct | MC4500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 130 ± 14 aa |
| Standard deviation of domain lengths | 14.03 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.65 |
| Pfam Score | 96.08 |
| Assigned Pfam label(s) | PF04133- CL0115 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8KMA2 | 7-145 | LSFFKISIIFVSVLIYHRLIGLAFSASVGLMLVVLACALPTFQVWWPMFVLVFYVLSPIPLLIAARIGDTDALSGSSNAIKETCLFI… |
| A2EJU3 | 3-126 | QAAPYIALGVFLAIELALVIISCVLDKNAYALIIIVPLCFAIICQFLADSYSDGYHEEGLLTVDTINWFFGVAFAASIGIPLMLWHD… |
| A0A453Q714 | 180-294 | None |
| A0A5F4W5Q7 | 4-131 | None |
| A0A7R9KE05 | 3-129 | None |
| A0A5S6Q6M7 | 1-117 | None |
| A0A6V7P1M9 | 146-268 | None |
| A0A833RKB3 | 25-160 | None |
| A0A1Y3ESW7 | 80-203 | None |
| D2W2V9 | 6-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.