DPCstruct | MC450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 222 ± 22 aa |
| Standard deviation of domain lengths | 21.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H8SZT6 | 2-213 | SRHLVKGLRILGERWTKGVRGWLAAGTNWLDTGVRWALVLGTLYGAAHLLLGSLLGVGAVALVVCVLALRAATKAARGQQLQAAKPG… |
| A0A429JIJ0 | 37-272 | AIRLMSTLGEGTSLLGKRLADRLKGWCLQAHRSDLKGLSADLGIYVRGALLLGAGAGLGWLVYRHNALMWPLAVGWSLAALRAKVSA… |
| A0A2P2GLA7 | 26-222 | None |
| A0A059WFV3 | 30-258 | None |
| A0A2M9KTP3 | 85-333 | None |
| Q8GGE7 | 2-245 | None |
| A0A7K3G5W6 | 2-196 | None |
| A0A7Z0TG90 | 14-202 | None |
| A0A1Q4YK98 | 213-406 | None |
| A0A229GU35 | 94-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.