DPCstruct | MC45
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 218 ± 28 aa |
| Standard deviation of domain lengths | 28.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 14.12 |
| Pfam Score | 47.06 |
| Assigned Pfam label(s) | CL0123- PF10987 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5V9L0 | 9-209 | LVKTARLLLFPIQILGSLQDRLERILIRIKHKIPEDKIKQADPKIIGPSLENLKYIQEDDVLFEAFINLITKSMNEDEYRNVHPAFP… |
| A0A353B6L2 | 18-254 | NLLERLAGKPCEIAGEIVADQLYAWQCARRISIFNKASENLKRERIDPRTIAPGFLMPLLEAAGNIDDEELQKLWANLLVSAVESDS… |
| K4ZM83 | 1-257 | None |
| A0A7S9GJC1 | 49-305 | None |
| A0A4Q4KU13 | 4-214 | None |
| A0A1V1V856 | 2-176 | None |
| A0A3S0SLN4 | 13-252 | None |
| A0A3R9M480 | 49-246 | None |
| A0A2N9L6M7 | 165-369 | None |
| B5ZDD1 | 1-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.