DPCstruct | MC44998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 145 ± 17 aa |
| Standard deviation of domain lengths | 16.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R7QD68 | 1-173 | MDAQRFHRAHTLGAENVQHSASEQVPGSAPPRVRLAELDPHIHCSVIGTCLGSAELRDIVARFAGFDVHKVSDFELHHAAVQIAAEG… |
| A0A6C2CZV1 | 1-121 | MDDKLHCPLIGTCLPIDELHRLAQRFKFKSPSTNEFGMHVEAVSLSQHRNPVAAAIQHYLEKTHKLWVDRFARLKTDAEVRLHWQEC… |
| A0A557SH85 | 1-145 | None |
| A0A102LCC3 | 1-115 | None |
| A0A7H1N540 | 5-143 | None |
| A0A846SWY6 | 33-190 | None |
| A0A5P2HAF0 | 53-205 | None |
| A0A2A5HPT6 | 1-166 | None |
| A0A1G0CRR2 | 21-156 | None |
| A0A2D7A8E9 | 3-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.