DPCstruct | MC44994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 127 ± 26 aa |
| Standard deviation of domain lengths | 26.24 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.06 |
| Pfam Score | 49.30 |
| Assigned Pfam label(s) | PF09696- CL0662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B5VKB9 | 64-196 | MPSVDIDASQWQKLTQSREKQTTVITPLGMMMLEIQGELELPKDFASLARRDSPNEGRFSEQDGETLIRFGSLQIDGERATLFVGKK… |
| A0A445CZA6 | 11-123 | EDKEEGRCKEWAIVELQGVVEPQPGFHDSLPNLQIGTLCRPSSQEVYTLTIGYHELTGSKVPLKKPMMVLKKVKHSPLDRGESSGCG… |
| A0A059AW81 | 51-146 | None |
| A0A6U3NRN2 | 3-133 | None |
| Q5BBV3 | 202-342 | None |
| A0A813BIW9 | 159-262 | None |
| A0A4S8MQ45 | 24-169 | None |
| A0A4Y7JCE6 | 239-371 | None |
| A0A7S2UGU6 | 54-186 | None |
| A0A016U7X0 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.