DPCstruct | MC44992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 202 ± 28 aa |
| Standard deviation of domain lengths | 28.11 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.09 |
| Pfam Score | 90.38 |
| Assigned Pfam label(s) | PF16558- CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H1VEA0 | 2-190 | TAHMKHHELDKVSRPKPDICRNANCGRTLHGVGSAGAVGSGTAMGQGPGNELGLCSLCFGPLYVSMHDPEGKALRRRIERRYLGQLM… |
| A0A421JP43 | 1-187 | MHELDKVQFNQLNKITFNKCCNENCINLLSGGVSTNELGLCDICYGPLYIAQHDPTNLKLQIRIERKYMIQLSKGCGNSWCNNEYCR… |
| Q0CU78 | 537-760 | None |
| A0A507D9K9 | 12-214 | None |
| A0A6A6GLI5 | 783-1009 | None |
| A0A099NSD0 | 54-204 | None |
| A0A5N6KGX3 | 290-508 | None |
| A0A2H1FW95 | 1038-1264 | None |
| A0A1E3QNE4 | 373-587 | None |
| A0A1E4TAP1 | 3-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.