DPCstruct | MC4499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 240 ± 44 aa |
| Standard deviation of domain lengths | 43.88 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 24.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482XFB8 | 2-200 | AHLQDILIDAGNIIENVLEIHRKKEENLLQAYVAARTIQKYYRGHLVRKHLKMLNAKTTIIQKHWRGVLGRKMYFQLLNDTVQKRCM… |
| A0A2G8KM73 | 1-286 | MASHIRLQGRLNEIMTTVFQRNSVAEEKRSAENQAAVTIQAWFRAVRVQNYICHLHQSATLIQKHWRGHQGRRVYRILIRNLVFVMR… |
| A0A383V9A3 | 2-278 | None |
| A0A6P8ZII2 | 2-179 | None |
| A0A834JCZ0 | 3-329 | None |
| A8B232 | 1-257 | None |
| W4GAP2 | 178-438 | None |
| A0A3Q3VXS1 | 3-236 | None |
| T1JL08 | 112-304 | None |
| S4RRA7 | 5-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.