DPCstruct | MC44989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 58 ± 1 aa |
| Standard deviation of domain lengths | 0.97 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 89.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 88.15 |
| Pfam Score | 88.89 |
| Assigned Pfam label(s) | CL0127- CL0266- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A893DCI8 | 367-424 | MGGSMGSVVGEKITRLIEYATNQFLPLIIVCASGGARMQEGSLSLMQMAKISSALYDY |
| A0A7J9L5L9 | 1-58 | MGGSMGSVVGEKITSLIEYATNNFLPLILVCAFEGARMQEGSLSLMQMAKISSALYDY |
| A0A4U5MZQ8 | 312-369 | None |
| A0A4Y5SFE6 | 266-323 | None |
| A0A445ET78 | 6-63 | None |
| A0A5N5IZR4 | 89-146 | None |
| A0A0B5HFB6 | 43-99 | None |
| A0A4S4DD60 | 60-116 | None |
| A0A5N6NCX3 | 405-461 | None |
| A0A6H0DZ12 | 468-524 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.