DPCstruct | MC44980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 215 |
|---|---|
| Mean domain length (aa) | 124 ± 33 aa |
| Standard deviation of domain lengths | 33.31 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 87.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.34 |
| Pfam Score | 98.35 |
| Assigned Pfam label(s) | CL0260- PF04381- CL0063- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D8MYJ5 | 15-109 | IPKELITSGFSSCYSRLDRDEPAVTITVNFVHPASNRCIHPILNRALTPREGARLQSFDDDFKFFGNRSEITKQIGNAVPPLLGKAI… |
| A0A239R377 | 109-215 | GPYDKKFMARNRVRGWDELSFTIQAQAKNEPLHPQAPKMVYVSPQERQFVKGKECLYRRLSVRECARIQTFPDSFKFVYDKVIDGYK… |
| A0A350PGB6 | 62-131 | None |
| A0A139PNE9 | 112-246 | None |
| A0A4V3SIJ0 | 771-919 | None |
| A0A167MDK8 | 2-85 | None |
| A0A437S9J0 | 563-693 | None |
| R9NZM2 | 399-592 | None |
| A0A4Q1EV43 | 84-178 | None |
| G2YS91 | 616-763 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.