DPCstruct | MC4498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 51 ± 4 aa |
| Standard deviation of domain lengths | 4.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 57.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1GQ93 | 104-151 | CHFDDIIDERSITKLCGYPLCDKELKNVPSKKYQISTVTNKVYDITER |
| A0A2G8KM11 | 1-51 | MPSHYTDAVEERSLEKLCGYPLCDHPLEETKQKYRISMKTNKVYDMSERKV |
| A7RWF2 | 115-170 | None |
| A0A0L7QZ66 | 42-87 | None |
| A0A7J8X650 | 47-102 | None |
| A0A3Q4M6P5 | 54-103 | None |
| A0A183DTA3 | 2-52 | None |
| T2M9E7 | 52-105 | None |
| E2B7R2 | 31-84 | None |
| A0A6P5W3V6 | 6-55 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.