DPCstruct | MC44978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 207 |
|---|---|
| Mean domain length (aa) | 163 ± 30 aa |
| Standard deviation of domain lengths | 30.25 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 14.58 |
| Pfam Score | 83.24 |
| Assigned Pfam label(s) | CL0123- CL0122 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1Q1D5 | 32-208 | GTYVKGNDVQQNIVSLNSITTDILAMGKVPSRKVLKFKVDKTFLKRAEELEIDNDDEVVILDRIYYADKEPINRTTDYLPAKYFPNI… |
| A0A800UFC5 | 7-117 | LLNSNRSTTEFVKGRFKKVQFGIIRQHETSDAIIRRAQFVLDGEPLIISTATIPKDNPLAFLRQVREQKTPIGDIIKDNKYCVERHI… |
| A0A1R0KEV5 | 15-181 | None |
| A0A419I6W0 | 7-120 | None |
| A0A0W1AB10 | 62-219 | None |
| A0A387H7I4 | 14-169 | None |
| A0A4U9HTK9 | 2-96 | None |
| A0A1Q9SKN1 | 34-189 | None |
| A0A1Q9SNG4 | 47-243 | None |
| A0A5E4SZT1 | 142-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.