DPCstruct | MC44977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 8.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0374 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7KJP3 | 72-144 | DNTREYDRTGLDQQRTELLDVELPLVTVPLNPGKNLTVICEVVAMNHLLRYSGVDSANAFNERLIRRMREKGG |
| A0A7J4V9Z3 | 9-83 | DPGVEYTRTGLDTDSTTIMEVDLPYIRLPIVPGKNITVITEVIALNYLLKHYGYDSAKVFRERLERKLRQADGEN |
| A0A7V9Q4E2 | 115-200 | None |
| A0A645HSR9 | 29-108 | None |
| A0A7W1E8F0 | 50-141 | None |
| A0A1V6HZU7 | 136-236 | None |
| A0A1S9D3E9 | 255-337 | None |
| A0A6L5DCX7 | 616-696 | None |
| A0A7V2Z224 | 282-361 | None |
| A0A7C4SYJ1 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.