DPCstruct | MC44975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Standard deviation of domain lengths | 3.79 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5RBV1 | 1-76 | WDWLEHDDPRLTEVMKGYALQAVFYFFLGEAFCDDADCRLFNAHRQSELIRAQLLSGKLCNKHRVMLEGFLRSSLR |
| A0A7J3ANT8 | 145-209 | LEFDDGRSPFVLRGYLLQCIFYAMTGNPFCSDRDCMLFNAHWQEEMLHAQIESGRLCAHHRRELN |
| A0A832SU33 | 47-114 | None |
| A0A1F9DZV8 | 194-261 | None |
| A0A7J3WH09 | 184-250 | None |
| A0A075FKY5 | 1-65 | None |
| A0A661VLN2 | 444-511 | None |
| A0A133UIM8 | 270-337 | None |
| A0A7V5IDT2 | 14-90 | None |
| A0A1I3QIH7 | 19-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.