DPCstruct | MC44973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 450 |
|---|---|
| Mean domain length (aa) | 75 ± 15 aa |
| Standard deviation of domain lengths | 15.47 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.99 |
| Pfam Score | 85.92 |
| Assigned Pfam label(s) | PF01556- PF00684 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5R9PN30 | 9-83 | CQDCNGAGQKRCQDCNGSGNETLRCEVCDGKGYSFEKNDSGEYVQIICTNCNGSGEVSKTCRACNGTGNFICPTC |
| A0A0F9LVF1 | 11-57 | SCPECDGIGEVVCDACGGKGGDCEHCKGLGHRVCRPCDGSGACPRCK |
| A0A7R9UFV6 | 97-169 | None |
| A0A819NIU7 | 39-124 | None |
| T1NPD1 | 197-266 | None |
| A0A7S2SS88 | 135-199 | None |
| A0A0C2J3N5 | 2-69 | None |
| A0A2D6PPF5 | 172-276 | None |
| A0A3D8IF31 | 142-207 | None |
| A0A1Y4H7B3 | 88-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.