DPCstruct | MC4497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 58 ± 6 aa |
| Standard deviation of domain lengths | 6.23 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 50.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8KL73 | 1-67 | MYNVLLDRHVQINNESAIEFYKHFGFEIIETKQHYYKRIEPAEAHVLQKTLKRSECQETQVESKEEK |
| A0A7S0S6J8 | 111-159 | EVAVHVQADNEEARKFYERHGFAVVETVKDYYKRLECTDALLLAKKLAR |
| A0A4U5NIY8 | 243-297 | None |
| A0A0V1BET4 | 338-395 | None |
| G3H065 | 155-216 | None |
| A0A6G1CEL3 | 451-500 | None |
| A0A673G4G6 | 84-145 | None |
| A0A821PVX6 | 652-719 | None |
| A0A6V7NZA9 | 190-241 | None |
| A0A812YU19 | 761-823 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.