DPCstruct | MC44950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 68 ± 9 aa |
| Standard deviation of domain lengths | 9.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 50.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813VSG1 | 1-73 | MAILYELHTLTTDKCIYNCNTCRQQCDIRYHCTVCEDFDLCEKCYNIESNHEHKMDKYNTLNINDKSSIITYC |
| A0A820G7H2 | 50-127 | RRAKFSTMALLYELHTSATNKFTYYCNTCQQECDIHFHCALCEDFDLCEKCYNIEPKHEHKMVKHNSLNINDKPIGSI |
| A0A0R4IPF2 | 1593-1650 | None |
| A0A820T2W6 | 178-260 | None |
| A0A1B0BU47 | 79-129 | None |
| A0A821TWH4 | 7-75 | None |
| A0A817L5V9 | 435-501 | None |
| A0A0S7GFM3 | 366-428 | None |
| A0A822CG28 | 13-84 | None |
| A0A4S2JUM0 | 54-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.