DPCstruct | MC44948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 143 ± 23 aa |
| Standard deviation of domain lengths | 23.24 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 31.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813U461 | 13-151 | RYWCATHVLQTQYTIQIVRCNSISGCGLWHSNYIQVFPHRFLPAPVAFERTPRGIAMAERDYQKGVFYGSLIHRIQFYSVVMQHTQN… |
| A0A164KD94 | 311-455 | ELDDEALLTKDEKLFSDHVKTSQYFLQILKCNNLECCMKPRSSYFSVILVHFLPPPIPLEQSSGGLKAPDRANDETHIFPLLFVSKT… |
| T1EP50 | 457-587 | None |
| A0A817S188 | 150-309 | None |
| A0A4C1VRP2 | 6-98 | None |
| A0A4C1W970 | 329-457 | None |
| A0A817LM87 | 10-187 | None |
| A0A820DVX1 | 11-142 | None |
| A0A4C1TB56 | 22-136 | None |
| A0A4C1TGP3 | 37-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.