DPCstruct | MC44946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 262 ± 36 aa |
| Standard deviation of domain lengths | 35.58 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18928 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0RC34 | 133-399 | ISLSELIRTSLIEQKQKSIVKDAYQELFDINEKLRQLVDKETRYERDAKDIKGLFLSFSLAKAYKSHASIVNLCKLGFGEDGAIISR… |
| A0A1J5SMQ8 | 8-299 | QQQKDLQEISELVHSFSSLGMDVIEHLLNASKIEKNKLASFFLFRQILEMGDAISVLINVGCINSCKPLIRSLIEYYFQLAYLLNEN… |
| A0A1M6M8Q2 | 32-346 | None |
| A0A4Z0R3C9 | 41-305 | None |
| A0A847D105 | 146-447 | None |
| A0A7R9N8M3 | 2-247 | None |
| A0A1G5WZ04 | 15-276 | None |
| A0A2E0LAK5 | 89-416 | None |
| A0A7K2AW77 | 18-258 | None |
| A0A7T7YZ11 | 315-652 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.