DPCstruct | MC4494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 151 ± 15 aa |
| Standard deviation of domain lengths | 14.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 67.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7UKB0 | 2-150 | DLLKRELEKKRKAATADFGGKSFVWRSELEKKQLQKRLDEHRQLLAKAGTSAPSANSAAAATGSEERRIDELDLPRHEVVRRLRVLR… |
| A0A0S7G983 | 1-135 | MNTFLFILAVLKLDKAEENEPSTSANPVLELELTEEKLPMTLSRQEVIRRLRERGEPIRLFGESDYDAFQRLRKIEILTPEVNKGLR… |
| B7FJ73 | 2-165 | None |
| A0A7R9PY73 | 1-166 | None |
| A0A556TQG7 | 1-132 | None |
| A0A182EFE4 | 50-176 | None |
| A0A2U9BXM9 | 1-149 | None |
| A0A7J7PD74 | 1-156 | None |
| A0A341B111 | 2-153 | None |
| A0A132A1X7 | 2-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.