DPCstruct | MC44937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 228 ± 26 aa |
| Standard deviation of domain lengths | 25.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812Q834 | 106-343 | RRNGLTFDEAISHTDGLKLVRLEKPLIVHKEPGCITVGDLPAKDEITDEIKKKVQFLDVLMNWEGELDFKKIEELFFQQRYSDLPHP… |
| A0A812QUE9 | 5-257 | NITLGNALEATNDLRIRQIPLRIRVGPMPAGAVAPVLLPLRELNPSAQQMKHFFGIIHDHEDRISYDALGPIIRDKAWSELPPFGFK… |
| A0A1Q9E5A4 | 242-493 | None |
| A0A812MU39 | 275-535 | None |
| A0A1Q9C3E8 | 20-246 | None |
| A0A1Q9CHP4 | 1-199 | None |
| A0A1Q9CIA1 | 1-186 | None |
| A0A1Q9D466 | 1-186 | None |
| A0A1Q9DAA9 | 16-268 | None |
| A0A1Q9DFB3 | 192-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.