DPCstruct | MC44936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 3.72 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 70.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0WXJ3 | 195-265 | WPGIWMLGNLGRAIFTASTNRIWPFSYSECDDSVFNSTNQRISACDDNPGHGLNPNQGRGAPEIDVLEGAA |
| H3GX59 | 199-267 | WPGIWMFGNLGRAIFTGSTARVWPFSYNECNETVFDSQNQRISACDPDPGSGMNPHQGRGAPEIDILEG |
| A0A396ZSW2 | 71-142 | None |
| A0A0A7CMJ4 | 201-269 | None |
| A0A3F2RX64 | 138-206 | None |
| A0A418DT27 | 170-238 | None |
| A0A3R7J8L3 | 190-268 | None |
| A0A6A4DQZ9 | 157-233 | None |
| A0A3R7A640 | 150-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.