DPCstruct | MC44935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 118 ± 18 aa |
| Standard deviation of domain lengths | 18.04 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 49.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812WUX9 | 333-444 | QGLRKGLVAQWAATPAGSLARFAFLKAFLLDKDLATIEVSPYYEELSESKEKEQYEELPLCIIQERYQNLPGGAKFLEDLQKSQVGK… |
| A0A812Q5P5 | 1-120 | FQFLKAFLLDREMASITIQPYFEELAEDKNKERYVELPLCMIRQKYDGIPGGDKFGQNLISSQKGRKHPQYDDDEWKIYKLFDQVAI… |
| A0A812IE37 | 636-734 | None |
| A0A812JGL6 | 1-129 | None |
| A0A812YLS9 | 40-187 | None |
| A0A812W2D4 | 370-476 | None |
| A0A812W269 | 448-591 | None |
| A0A812SUF1 | 1-135 | None |
| A0A812J476 | 539-645 | None |
| A0A812IE20 | 86-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.