DPCstruct | MC44934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 203 ± 38 aa |
| Standard deviation of domain lengths | 38.08 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812Q2L5 | 26-233 | SGDRYAASLGEMNSYVQMIFEDRGLGTLERHRVRMSTCMISQEALRDPVVACKLGNLYNKEAVIAALLNRKMPEDLSHIRALKDVKQ… |
| A0A7H9HWV2 | 2-159 | WKYCRLSNKKLQLPIMSDYKGHLFNKEAILEWLLTPGREDYTDAQIAEFSHIKRLDDVVELHGVEERADTLKCQYGDIALGETNAKL… |
| U6MR90 | 4-176 | None |
| N4X071 | 479-742 | None |
| A0A654HG03 | 1-231 | None |
| A0A6D2HEQ5 | 37-227 | None |
| A0A5E4EKL6 | 2-159 | None |
| A0A7R9A201 | 414-555 | None |
| A0A7S0M3Z7 | 51-264 | None |
| A0A7M5VBY5 | 2-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.