DPCstruct | MC44930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 199 ± 17 aa |
| Standard deviation of domain lengths | 17.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812NR06 | 1-196 | MKVDDKTYQKFWWFKKGSKWPTGKTDVLGDNFGDCKSSDAVCFQKLPEVKEEGLLLLAIDSEGNQFEWTFDSLNPVAHAAYKALRHG… |
| C3Z3F4 | 90-254 | MAYETIDEYGRVWEKFWWWKAGSRWSVAITDVLQDSYGTCDPDSDYCMGRLPSWLQEDRTELLAKDSRGNVYKWGFDSNNPTAHAAW… |
| A0A1S3IDL9 | 74-293 | None |
| A0A1S3IAQ7 | 1-223 | None |
| A0A1Q9D6P7 | 130-320 | None |
| A0A1Q9DTK3 | 101-315 | None |
| A0A812VAD9 | 330-529 | None |
| A0A7D9JJP4 | 270-455 | None |
| A0A812THC3 | 670-862 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.