DPCstruct | MC4493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 178 ± 22 aa |
| Standard deviation of domain lengths | 21.56 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8KHC7 | 8-178 | NKLLFHQLQISFMHFKVTGRKVSYKLVSRAKSLNWSVEWGLDEDSNLLKGIYEYGVGNWEALKMDPELNLHEKILLPDPDKKPQAKQ… |
| A0A1Y2BEL7 | 125-264 | DLLTGRIHDMKDLSHGLEELTKDLSEFEFPLPRNWDIDWTWTDDAMLLYGVYKHGYGSWQLIEQDEELPFRDRFFLGSSEDKKPKDR… |
| A0A395IVB0 | 79-272 | None |
| A0A7E4SAF9 | 66-251 | None |
| A0A2G9S6P9 | 5-150 | None |
| A0A178VS84 | 49-243 | None |
| S9XNG0 | 616-836 | None |
| A0A7S2Z7V7 | 1-176 | None |
| A0A164MZU9 | 1-171 | None |
| A0A0B2W090 | 384-587 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.