DPCstruct | MC4492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 117 ± 8 aa |
| Standard deviation of domain lengths | 8.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8KGK8 | 68-176 | SQPPLKTVKGFGRFKAKLADILTEKNSLQLATFFHYPPAKIDLLKQNKDSRNHLMIRYMEERGEITETDITTLLHALKVLNLHVIKK… |
| A0A2G8JCI4 | 1-114 | MAANVNPVDIKPDLKKAVNGFGSFKVALATVLTVKIVLDLATFFEYPPVVIEELSNAAASSGLLMIRYMEERGQIEPTSIMTLLCAL… |
| A0A2G8JMR4 | 1-120 | None |
| A0A2G8LFH9 | 1-112 | None |
| A0A2G8L487 | 1-132 | None |
| A0A2G8L1K1 | 1-113 | None |
| A0A2G8LJV9 | 503-602 | None |
| A0A2G8JJW0 | 69-195 | None |
| A0A2G8KHN0 | 1-116 | None |
| A0A2G8KX52 | 5-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.