DPCstruct | MC44918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 248 ± 33 aa |
| Standard deviation of domain lengths | 33.14 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19795 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812ISH4 | 613-870 | VDEQQSEEERLVKWQMSDYLDLNSDQRKLLETQIEGLMAWHRREHLPEYAILMESLATQWSDGVSEAQIQSLFEQMFIWGEDIQEQG… |
| A0A3F2V3D0 | 2-241 | ELDGRQEDAFRSDLDRYLAWHRTEQLPLYAQFLNQVADEAETGLSVDDIARVQLQSEQFAATLVERMKPDLIELFATATDEQVDQLF… |
| A0A4U8VD80 | 53-338 | None |
| A0A7X8TTY7 | 39-311 | None |
| M4V8W3 | 18-278 | None |
| A0A395JPC9 | 18-290 | None |
| A0A1T4UQ44 | 12-283 | None |
| A0A258P0G9 | 15-247 | None |
| A0A7Y8VH65 | 4-197 | None |
| A0A845JXW4 | 1-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.