DPCstruct | MC44917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 162 ± 28 aa |
| Standard deviation of domain lengths | 27.98 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 91.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812IRJ5 | 465-641 | EPEWLEIEYERGDPIALNGQALTPGAMLRTLNELGGKHGVGRSDLVENRYVGMKSRGCYETPGGTILLKSHRAIESITLDREVAHLK… |
| A0A7U8U615 | 176-355 | IVGFERGVPVSVDGKPVSMLAAIEELNRRAGAQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHTELEHVTLERELGRFKRQTDQ… |
| A0A7J0GAN4 | 4-144 | None |
| A0A5N5ICM9 | 290-465 | None |
| A0A7R9KWP3 | 172-360 | None |
| A0A2B4S7F2 | 225-403 | None |
| A0A7Y5EW81 | 9-160 | None |
| A0A667I390 | 409-591 | None |
| A0A4Q4UTB6 | 115-276 | None |
| A0A5J5CR08 | 343-510 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.