DPCstruct | MC44916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 348 ± 57 aa |
| Standard deviation of domain lengths | 57.14 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.52 |
| Pfam Score | 95.34 |
| Assigned Pfam label(s) | CL0039- PF20979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812IRJ5 | 279-642 | VTFTADIGQGEEVEPARAKAKAMGVKEIFIEDLTEDFVANYVYPMFRANTVYEGEYLLGTSIARPLITRRLVEIARQTGAQAVAHGA… |
| A0A7U8U615 | 2-343 | DVIRQRALDCGAVEAVVVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVKHLVAAAREHGGGIVAHGCTGKGNDQVRFEVG… |
| A0A2B4S7F2 | 24-409 | None |
| A0A667I390 | 297-585 | None |
| A0A4T0HEV2 | 27-413 | None |
| A0A5Q3DQG5 | 9-416 | None |
| A0A6L5C892 | 311-648 | None |
| A0A7V1K436 | 2-291 | None |
| A0A7R9KWP3 | 7-359 | None |
| A0A0R0IGZ2 | 2-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.