DPCstruct | MC44910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 127 ± 10 aa |
| Standard deviation of domain lengths | 10.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C3YN49 | 192-312 | LETFRSVRPHILIRFGKWEEIIETSLPQDQELLCVTTATIHYAKGVAYAALGNVDESAKQRELFLSAKARVPPTRIAYPNKCSDVLD… |
| A0A0D2G7S8 | 1-122 | MEFFKSVRLHVYIRFGLWDAIKAHELPEDQELYCVTTTFAHYAKGLAWAVSGHLDKADKERTLYQAVAARIPPSRKDFLNTISDQLR… |
| A0A423WVK2 | 623-755 | None |
| A0A1V6TI19 | 726-858 | None |
| A0A0F4GY58 | 866-1000 | None |
| A0A7S9DNV9 | 21-155 | None |
| A0A3L6N0P4 | 119-240 | None |
| T5AGB1 | 119-229 | None |
| B8BRP2 | 1010-1141 | None |
| A0A1Q5UBA8 | 269-402 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.