DPCstruct | MC4491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 99 ± 10 aa |
| Standard deviation of domain lengths | 9.94 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8QFB5 | 1-93 | MAWKRRLYLSLALARLYFALTPSYIHPDEHFQGPEVVAGEHFGWKVTRTWEFTTEKPIRSYVPLLAVYAMPMTLLQWIANGDPSPTM… |
| A0A7C8U8E3 | 5-91 | RRLYLSLALARLYFALTPSYIHPDEHFQGPEVVAGEHFGWKVTRTWEFTTEKPIRSYVPLLAVYAMPMTLLQWIANGDPSPTMLFYA |
| A0A367YL43 | 1-96 | None |
| A0A1V4K3X9 | 3-102 | None |
| A0A1S3CXZ4 | 17-120 | None |
| A0A2H8TLE4 | 1-93 | None |
| A0A7R9BRD6 | 1-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.