DPCstruct | MC44906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 103 ± 10 aa |
| Standard deviation of domain lengths | 9.92 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 65.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7PUB3 | 11-102 | SIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLREMVQECYELAAEYEGKHDSHKLDELGNVLTSLDAGDLIVVTKS… |
| A0A2K3N3R5 | 2-98 | ASIDAQLRLLAPSKVSDDDKLVEYDALLLDRFLDILQDLHGGDIRETVQDCYELSAEYEGNNNPQKLEELGNMLTGLDAGDSIVIAK… |
| A0A835H016 | 1-88 | None |
| A0A804RQH4 | 1-110 | None |
| A0A3L6GAD8 | 54-163 | None |
| A0A2S3HYW9 | 40-154 | None |
| A0A5J5T3B6 | 13-112 | None |
| A0A804QNR1 | 1-111 | None |
| A0A1D6I1V6 | 6-105 | None |
| A0A834H0C5 | 31-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.