DPCstruct | MC44905
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 174 ± 15 aa |
| Standard deviation of domain lengths | 15.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 58.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7PTL2 | 1-167 | MKIILQENRGYSYRLEKHALNALIAGPLLWLVGSILNACQVYERADGRTQILQSSVNLPFLMGSLLFLVGGFFNRHYVSGSPHPESE… |
| A0A6G1EQ60 | 105-254 | VGCVLAVVAMVLLISQGRETHAANTLLAAAVVWLVGSVLNSCQVYERADGRAQLLQSSVQVPLLLGSLLFLVAGVVNRRREPPVLVG… |
| A0A453ECP0 | 53-217 | None |
| A0A836B2W1 | 68-255 | None |
| A0A0B2SGV5 | 1-194 | None |
| A0A445L4G6 | 103-292 | None |
| A0A438CU57 | 686-848 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.