DPCstruct | MC4490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 141 ± 40 aa |
| Standard deviation of domain lengths | 40.06 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 77.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.98 |
| Pfam Score | 69.23 |
| Assigned Pfam label(s) | PF16165- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7GW93 | 68-182 | IPPRLTMQVWDADHFSADDFLGAIELDLNRFPRGAKTAKLCNLDMIRNEQELPTISIFKQKRVKGWWPFVARDENDEMELTGKVEAE… |
| A0A2G8KFV1 | 1-110 | MTILAYLTCSCTLDLNRFPRGAKTSKKCTPDILKMDGTVPLMNLFKLKRHKGWWPFMAQSEHEEEELTGKVEAEMHLMTEEEAEKSP… |
| A0A0R3QTY1 | 163-319 | None |
| F1L327 | 114-269 | None |
| A0A6A5FIR9 | 595-823 | None |
| A0A7J7KR59 | 75-193 | None |
| A0A6P9AXB8 | 258-462 | None |
| A0A7J7IXB1 | 281-407 | None |
| T1K6Z8 | 166-281 | None |
| A0A819I627 | 2-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.